PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.40049s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 346aa    MW: 38953.1 Da    PI: 6.7994
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.40049s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.21.2e-30203258156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k+r++W+peLH+rF++a++qLGG+ +AtPk+i+e+m+ +gLt+++vkSHLQkYRl+
  Araha.40049s0004.1.p 203 KQRRCWNPELHRRFLDALQQLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRLH 258
                           79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.274200260IPR017930Myb domain
SuperFamilySSF466899.86E-17201261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-26202261IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-25203258IPR006447Myb domain, plants
PfamPF002495.7E-8205256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGSLGDELSL GSIFVRGVSM NVVAVEKVDE HVKKLEEEKR KIESCKLELP LSLQILNDAI  60
LYLKDKRCLE METQPLLKDF ISFNREEGEM ELVKRDELMM EKKFQQWKAN DDHISNRRFS  120
DTSKIKSKLE IERNQRNEEK SSMLLIPKVE TGLGLGLGLS SIRRKGIVAS CGGFTSNSMP  180
QPPPPAAVVP QQPAFLQQQA LRKQRRCWNP ELHRRFLDAL QQLGGPGVAT PKQIREHMQE  240
EGLTNDEVKS HLQKYRLHIR KPNSNAEKQS RVVLGFNLWN SSSQDQEEET GEGGESSKRS  300
NSQSDSPQGP LQLPSTTTTT GGDSSMEDVE DAKSESIQME RLRSP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2216310.0AK221631.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-96-G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564549.10.0myb family transcription factor
TrEMBLQ9FX840.0Q9FX84_ARATH; F14J22.20 protein
STRINGAT1G49560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139271824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.11e-171G2-like family protein